PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G098400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 179aa    MW: 20449.6 Da    PI: 9.593
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G098400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.17.3e-284999252
              RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                        e  +++e +s+yF++pi +AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  Sevir.4G098400.1.p 49 ETVLTFELVSQYFYMPIMQAARELNVGLTLLKKRCRELGIPRWPHRKMKSL 99
                        5679*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.6134119IPR003035RWP-RK domain
PfamPF020423.7E-225299IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEQADSKAED GHTTKGLPLL CYGEEKEVSS NSGTMVVGAD QQRVRPEAET VLTFELVSQY  60
FYMPIMQAAR ELNVGLTLLK KRCRELGIPR WPHRKMKSLQ SLINNVQVLQ EAGKATGEEQ  120
LRAMVEMLQQ EKQLLEQRPY VQLDEKTKRL RQACFKANYK KRRLLALEAG EAPRSHKY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035097e-52AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035697e-52AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149627e-52AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126147e-52CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966836.11e-128PREDICTED: protein RKD2
SwissprotQ9M9U96e-44RKD1_ARATH; Protein RKD1
TrEMBLK3Y2531e-128K3Y253_SETIT; Uncharacterized protein
STRINGSi008273m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.18e-40RWP-RK domain-containing protein